missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SHE (aa 231-294) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP96523
Description
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57944 (PA5-57944. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
SHE, also known as SH2 domain-containing adapter protein E, is a 495 amino acid protein whose molecular weight is 54 kDa. The function of SHE remains unknown.Specifications
| Q5VZ18 | |
| Blocking Assay, Control | |
| 126669 | |
| 100 μL | |
| 9430022A14; RGD1563897; SH2 domain-containing adapter protein E; SHE; Src homology 2 domain containing E; src homology 2 domain-containing transforming protein E | |
| SHE | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SHE (aa 231-294) Control Fragment | |
| RUO | |
| SHE | |
| Unconjugated | |
| Recombinant | |
| PYDAQQMITEIRRRGSKDPLVKALQLLDSPCEPADGGLKSETLAKRRSSKDLLGKPPQLYDTPY | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |