missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SHB (aa 213-269) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP99509
Description
Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62088 (PA5-62088. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The SH2 (Src Homology 2) domain is a structurally conserved motif that contains two alpha helices and seven beta strands and is found in a variety of proteins that are involved in signal transduction throughout the cell. Specifically, the SH2 domain targets SH2 domain-containing proteins to tyrosinephosphorylated sites, an event that can trigger a protein-protein interaction cascade which may ultimately effect gene expression and cellular function. Shb (SH2 domain-containing adapter protein b), Shd (SH2 domain-containing adapter protein d), She (SH2 domain-containing adapter protein e) and Shf(SH2 domain-containing adapter protein f) are SH2 domain-containing proteins that play various roles throughout the cell.Specifications
| Q15464 | |
| Blocking Assay, Control | |
| 6461 | |
| 100 μL | |
| bA3J10.2; BC028832; SH2 domain containing adaptor protein B; SH2 domain-containing adapter protein B; Shb; SHB (Src homology 2 domain containing) adaptor protein B; SHB adaptor protein (a Src homology 2 protein); Src homology 2 domain containing adaptor protein B; src homology 2 domain-containing transforming protein B | |
| SHB | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SHB (aa 213-269) Control Fragment | |
| RUO | |
| SHB | |
| Unconjugated | |
| Recombinant | |
| TACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYM | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |