missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP99509

Invitrogen™ Human SHB (aa 213-269) Control Fragment Recombinant Protein

Catalog No. RP99509
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99509 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99509 Supplier Invitrogen™ Supplier No. RP99509

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62088 (PA5-62088. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The SH2 (Src Homology 2) domain is a structurally conserved motif that contains two alpha helices and seven beta strands and is found in a variety of proteins that are involved in signal transduction throughout the cell. Specifically, the SH2 domain targets SH2 domain-containing proteins to tyrosinephosphorylated sites, an event that can trigger a protein-protein interaction cascade which may ultimately effect gene expression and cellular function. Shb (SH2 domain-containing adapter protein b), Shd (SH2 domain-containing adapter protein d), She (SH2 domain-containing adapter protein e) and Shf(SH2 domain-containing adapter protein f) are SH2 domain-containing proteins that play various roles throughout the cell.

Specifications

Accession Number Q15464
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6461
Name Human SHB (aa 213-269) Control Fragment
Quantity 100 μL
Gene Alias bA3J10.2; BC028832; SH2 domain containing adaptor protein B; SH2 domain-containing adapter protein B; Shb; SHB (Src homology 2 domain containing) adaptor protein B; SHB adaptor protein (a Src homology 2 protein); Src homology 2 domain containing adaptor protein B; src homology 2 domain-containing transforming protein B
Common Name SHB
Gene Symbol SHB
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TACGGKKLLNKCAASAAEESGAGKKDKVTIADDYSDPFDAKNDLKSKAGKGESAGYM
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less