missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP93281

Invitrogen™ Human SGSM2 (aa 717-810) Control Fragment Recombinant Protein

Catalog No. RP93281
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP93281 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP93281 Supplier Invitrogen™ Supplier No. RP93281

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (80%), Rat (80%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54478. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Small G proteins such as RAP and RAB proteins are the key molecules in intracellular signal transduction and vesicle transportation. A novel protein family small G protein signaling modulator (SGSM) consisting of three members SGSM1-3 bind to RAP and RAB family proteins. All three SGSM proteins possess both a RUN domain and a TBC domain. SGSM2 is a Rab9A effector that activates GTP hydrolysis by Rab32 and Rab33B proteins.

Specifications

Accession Number O43147
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 9905
Name Human SGSM2 (aa 717-810) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias D630003G22Rik; KIAA0397; mKIAA0397; R74628; RUN and TBC1 domain containing 1; RUN and TBC1 domain-containing protein 1; RUTBC1; Sgsm2; Small G protein signaling modulator 2; small G protein signaling modulator 2 protein
Common Name SGSM2
Gene Symbol SGSM2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SGIQSSLDEGQSVGFEEEDGGGEEGSSGPGPAAHTLREPQDPSQEKPQAGELEAGEELAAVCAAAYTIELLDTVALNLHRIDKDVQRCDRNYWY
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less