missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Sgk110 (aa 16-54) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP108702
Description
Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-85058 (PA5-85058. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Sgk110 is a protein coding gene.Specifications
| P0C264 | |
| Blocking Assay, Control | |
| 100130827 | |
| 100 μL | |
| Gm1078; Sbk3; Sgk110; SH3 domain binding kinase family member 3; SH3 domain binding kinase family, member 3; SH3-binding domain kinase family member 3; Sugen kinase 110; uncharacterized serine/threonine-protein kinase SBK3 | |
| Sbk3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Sgk110 (aa 16-54) Control Fragment | |
| RUO | |
| Sgk110 | |
| Unconjugated | |
| Recombinant | |
| EDTATALQRLVELTTSRVTPVRSLRDQYHLIRKLGSGSY | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |