missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SFMBT2 (aa 230-315) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP97215
Description
Highest antigen sequence indentity to the following orthologs: Mouse (77%), Rat (77%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83272 (PA5-83272. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The SFMBT2 (Scm-like with four MBT domains 2) gene shares high similarity with the Drosophila Scm (sex comb on midleg) gene. Sfmbt2 is a Polycomb group (PcG) gene that maps to the proximal region of Chromosome 2, and is a putative imprinted gene. Sfmbt2 is the first imprinted gene within this region to be identified. Studies indicate that six different translocations involving proximal chromosome 2 results in lethality when present as a maternal uniparental duplication.Specifications
| Q5VUG0 | |
| Blocking Assay, Control | |
| 57713 | |
| 100 μL | |
| D2Wsu23e; D330030P06Rik; KIAA1617; Scm-like with 4 MBT domains protein 2; Scm-like with four mbt domains 2; scm-like with four MBT domains protein 2; Scm-related gene containing four mbt domain 2; Scm-related gene containing four mbt domains 2; SFMBT2 | |
| SFMBT2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SFMBT2 (aa 230-315) Control Fragment | |
| RUO | |
| SFMBT2 | |
| Unconjugated | |
| Recombinant | |
| DQWLFYLDYRLRPVGWCQENKYRMDPPSEIYPLKMASEWKCTLEKSLIDAAKFPLPMEVFKDHADLRSHFFTVGMKLETVNMCEPF | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |