missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94946

Invitrogen™ Human SF3B5 (aa 3-86) Control Fragment Recombinant Protein

Catalog No. RP94946
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP94946 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP94946 Supplier Invitrogen™ Supplier No. RP94946
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62963 (PA5-62963. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SF3B5 is a protein coding gene involved in pre-mRNA splicing as a component of the splicing factor SF3B complex, a constituent of the spliceosome. SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA.

Specifications

Accession Number Q9BWJ5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 83443
Name Human SF3B5 (aa 3-86) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 10 kDa; 1110005L13Rik; AU043053; MGC3133; pre-mRNA-splicing factor SF3b 10 kDa subunit; Sf3b10; SF3b10-like; SF3b5; si:ch211-8a9.5; splicing factor 3 B subunit 10; splicing factor 3 B subunit 5; splicing factor 3 b, subunit 5; splicing factor 3 b, subunit 5, 10 kDa; Ysf3; zgc:92874
Common Name SF3B5
Gene Symbol Sf3b5
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DRYTIHSQLEHLQSKYIGTGHADTTKWEWLVNQHRDSYCSYMGHFDLLNYFAIAENESKARVRFNLMEKMLQPCGPPADKPEEN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less