missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101588

Invitrogen™ Human SERPINA5 (aa 208-264) Control Fragment Recombinant Protein

Catalog No. RP101588
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101588 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101588 Supplier Invitrogen™ Supplier No. RP101588

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-140302. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the serine proteinase inhibitor (serpin) superfamily. This member is the principal inhibitor of tissue plasminogen activator (tPA) and urokinase (uPA), and hence is an inhibitor of fibrinolysis. Defects in this gene are the cause of plasminogen activator inhibitor-1 deficiency (PAI-1 deficiency), and high concentrations of the gene product are associated with thrombophilia. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

Accession Number P05154
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 5104
Name Human SERPINA5 (aa 208-264) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 4933415L04; acrosomal serine protease inhibitor; alpha-1 antiproteinase; antitr; antitrypsin; LOC480424; LOC483954; PAI3; PAI-3; Pci; PCI-B; PLANH3; Plasma serine protease inhibitor; plasminogen activator inhibitor 3; plasminogen activator inhibitor III; plasminogen activator inhibitor-3; PROCI; Protein C inhibitor; serine (or cysteine) peptidase inhibitor, clade A, member 5; serine (or cysteine) proteinase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 5; serine (or cysteine) proteinase inhibitor, clade A, member 5; serpin A5; serpin B3; serpin family A member 5; serpin family B member 3; serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 5; serpin peptidase inhibitor, clade A, member 5; serpin peptidase inhibitor, clade B (ovalbumin), member 4; SERPINA5; SERPINB3; SERPINB4
Common Name SERPINA5
Gene Symbol SERPINA5
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KWETSFNHKGTQEQDFYVTSETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQGNAT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less