missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SENP3 (aa 309-396) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP101397
Description
Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84450 (PA5-84450. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins is required for numerous biologic processes. SUMO-specific proteases, such as SENP3, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates.Specifications
| Q9H4L4 | |
| Blocking Assay, Control | |
| 26168 | |
| 100 μL | |
| AA408656; DKFZP586K0919; DKFZp762A152; SENP3; sentrin/SUMO-specific protease 3; sentrin/SUMO-specific protease SENP3; Sentrin-specific protease 3; Smt3ip; Smt3ip1; Smt3-specific isopeptidase 1; SSP3; SUMO specific peptidase 3; SUMO/sentrin specific peptidase 3; SUMO/sentrin specific protease 3; SUMO1/sentrin/SMT3 specific peptidase 3; SUMO1/sentrin/SMT3 specific protease 3; SUMO-1-specific protease 3; SUSP3; Ulp1 | |
| Senp3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SENP3 (aa 309-396) Control Fragment | |
| RUO | |
| SENP3 | |
| Unconjugated | |
| Recombinant | |
| LREEHVTCVQSILDEFLQTYGSLIPLSTDEVVEKLEDIFQQEFSTPSRKGLVLQLIQSYQRMPGNAMVRGFRVAYKRHVLTMDDLGTL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |