missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP89232

Invitrogen™ Human SENP1 (aa 85-204) Control Fragment Recombinant Protein

Catalog No. RP89232
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP89232 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP89232 Supplier Invitrogen™ Supplier No. RP89232

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SENP1 is a protease that catalyzes two essential functions in the SUMO pathway: processing of full-length SUMO1, SUMO2 and SUMO3 to their mature forms and deconjugation of SUMO1, SUMO2 and SUMO3 from targeted proteins. SENP deconjugates SUMO1 from HIPK2 and from HDAC1, which decreases the transcriptional repression activity of the latter.

Specifications

Accession Number Q9P0U3
Concentration 1.60 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 29843
Name Human SENP1 (aa 85-204) Control Fragment
pH Range 7.4
Purification Method Metal-chelate chromatography
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias 2310046A20Rik; D15Ertd528e; E330036L07Rik; SEN1; Senp1; sentrin/SUMO-specific protease SENP1; Sentrin-specific protease 1; SUMO-1 protease 2; SUMO1/sentrin specific peptidase 1; SUMO1/sentrin specific protease 1; Sumo1/sentrin/SMT3 specific peptidase 1; Supr2; suPr-2
Common Name SENP1
Gene Symbol SENP1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GDLRTFGQSANGQWRNSTPSSSSSLQKSRNSRSLYLETRKTSSGLSNSFAGKSNHHCHVSAYEKSFPIKPVPSPSWSGSCRRSLLSPKKTQRRHVSTAEETVQEEEREIYRQLLQMVTGK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less