missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96386

Invitrogen™ Human SEC13 (aa 129-218) Control Fragment Recombinant Protein

Catalog No. RP96386
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96386 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96386 Supplier Invitrogen™ Supplier No. RP96386

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111059 (PA5-111059. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene belongs to the SEC13 family of WD-repeat proteins. It is a constituent of the endoplasmic reticulum and the nuclear pore complex. It has similarity to the yeast SEC13 protein, which is required for vesicle biogenesis from endoplasmic reticulum during the transport of proteins. Multiple alternatively spliced transcript variants have been found.

Specifications

Accession Number P55735
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6396
Name Human SEC13 (aa 129-218) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110003H02Rik; D3S1231E; GATOR complex protein SEC13; npp-20; Protein SEC13 homolog; Sec13; SEC13 homolog; SEC13 homolog (S. cerevisiae); SEC13 homolog, nuclear pore and COPII coat complex component; SEC13 homolog, nuclear pore and COPII coating complex component; SEC13 related; SEC13A; Sec13l1; SEC13-like 1; SEC13-like 1 isoform; SEC13-like protein 1; SEC13R; SEC13-related protein
Common Name SEC13
Gene Symbol SEC13
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPGSLIDHPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less