missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91451

Invitrogen™ Human SCYL1 (aa 303-430) Control Fragment Recombinant Protein

Catalog No. RP91451
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91451 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91451 Supplier Invitrogen™ Supplier No. RP91451
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53267 (PA5-53267. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

With approximately 135 million base pairs and 1,400 genes, chromosome 11 makes up around 4% of human genomic DNA and is considered a gene and disease association dense chromosome. The chromosome 11 encoded Atm gene is important for regulation of cell cycle arrest and apoptosis following double strand DNA breaks. Atm mutation leads to the disorder known as ataxia-telangiectasia. The blood disorders Sickle cell anemia and β thalassemia are caused by HBB gene mutations. Wilms' tumors, WAGR syndrome and Denys-Drash syndrome are associated with mutations of the WT1 gene. Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema and Smith-Lemli-Opitz syndrome are also associated with defects in chromosome 11.

Specifications

Accession Number Q96KG9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57410
Name Human SCYL1 (aa 303-430) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 105 kDa kinase-like protein; 2810011O19Rik; C85140; Coated vesicle-associated kinase of 90 kDa; CVAK90; GKLP; HT019; likely ortholog of mouse N-terminal kinase-like protein; mdf; mfd; Mitosis-associated kinase-like protein NTKL; NKTL; N-terminal kinase-like protein; NTKL; P105; SCAR21; SCY1 like pseudokinase 1; SCY1-like 1 (S. cerevisiae); SCY1-like 1 splice variant 13; SCY1-like 1 splice variant 15; SCY1-like protein 1; SCY1-like, kinase-like 1; Scyl1; TAPK; TEIF; Telomerase regulation-associated protein; Telomerase transcriptional element-interacting factor; telomerase transcriptional elements-interacting factor; teratoma-associated tyrosine kinase; TRAP; ubiquitous protein kinase-like (105 kDa)
Common Name SCYL1
Gene Symbol Scyl1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AFPEDFCRHKVLPQLLTAFEFGNAGAVVLTPLFKVGKFLSAEEYQQKIIPVVVKMFSSTDRAMRIRLLQQMEQFIQYLDEPTVNTQIFPHVVHGFLDTNPAIREQTVKSMLLLAPKLNEANLNVELMK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less