missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP102629

Invitrogen™ Human SCRN3 (aa 345-423) Control Fragment Recombinant Protein

Catalog No. RP102629
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP102629 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP102629 Supplier Invitrogen™ Supplier No. RP102629

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (66%), Rat (66%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57016 (PA5-57016. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SCRN3 is a member of the secernin family of proteins which includes the homologous SCRN1, a protein that was first identified as being involved in the regulation of exocytosis from peritoneal mast cells. Little is known of SCRN3, but studies have shown that SCRN1 may possess epitopes that function as tumor-associated antigens in gastric cancers and increased SCRN1 expression in patients with colorectal cancer correlated with poor prognosis, suggesting that SCRN3 may also be involved in protein secretion or the regulation of cell growth.

Specifications

Accession Number Q0VDG4
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 79634
Name Human SCRN3 (aa 345-423) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 4833415E20Rik; AI427019; AV002033; Scrn3; secernin 3; secernin-3; Ses3
Common Name SCRN3
Gene Symbol Scrn3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RRHPLYQKHQQALEVVNNNEEKAKIMLDNMRKLEKELFREMESILQNKHLDVEKIVNLFPQCTKDEIQIYQSNLSVKVS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less