missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SASH1 (aa 744-838) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP94666
Description
Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56304 (PA5-56304. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
May have a role in a signaling pathway. Could act as a tumor suppressor.Specifications
| O94885 | |
| Blocking Assay, Control | |
| 23328 | |
| 100 μL | |
| 1100001C18Rik; 2500002E12Rik; A330076K04Rik; dJ323M4; dJ323M4.1; KIAA0790; mKIAA0790; PEPE1; Proline-glutamate repeat-containing protein; putative adapter and scaffold protein 1; RGD1566017; SAM and SH3 domain containing 1; SAM and SH3 domain-containing protein 1; Sash1; SH3D6A | |
| SASH1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SASH1 (aa 744-838) Control Fragment | |
| RUO | |
| SASH1 | |
| Unconjugated | |
| Recombinant | |
| LLSAKSSTEPSLKSFSRNQLGNYPTLPLMKSGDALKQGQEEGRLGGGLAPDTSKSCDPPGVTGLNKNRRSLPVSICRSCETLEGPQTVDTWPRSH | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |