Learn More
Invitrogen™ Human SART3 (aa 376-482) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP91603
Description
Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111198 (PA5-111198. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is an RNA-binding nuclear protein that is a tumor-rejection antigen. This antigen possesses tumor epitopes capable of inducing HLA-A24-restricted and tumor-specific cytotoxic T lymphocytes in cancer patients and may be useful for specific immunotherapy. This gene product is found to be an important cellular factor for HIV-1 gene expression and viral replication. It also associates transiently with U6 and U4/U6 snRNPs during the recycling phase of the spliceosome cycle. This encoded protein is thought to be involved in the regulation of mRNA splicing.Specifications
Q15020 | |
Blocking Assay, Control | |
9733 | |
100 ÎĽL | |
AU045857; DSAP1; HIV-1 Tat-interacting protein of 110 kDa; hSART-3; Kiaa0156; MGC138188; mKIAA0156; mSART-3; P100; p110; p110 nuclear RNA-binding protein; p110(nrb); RP11-13G14; Sart3; SART-3; spliceosome associated factor 3, U4/U6 recycling protein; squamous cell carcinoma antigen recognised by T cells 3; squamous cell carcinoma antigen recognized by T cells 3; squamous cell carcinoma antigen recognized by T-cells 3; Tat-interacting protein of 110 kDa; Tip110; Tumor-rejection antigen SART3 | |
SART3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human SART3 (aa 376-482) Control Fragment | |
RUO | |
SART3 | |
Unconjugated | |
Recombinant | |
PWTVALWSRYLLAMERHGVDHQVISVTFEKALNAGFIQATDYVEIWQAYLDYLRRRVDFKQDSSKELEELRAAFTRALEYLKQEVEERFNESGDPSCVIMQNWARIE | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |