missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP107831

Invitrogen™ Human SAPCD1 (aa 47-118) Control Fragment Recombinant Protein

Catalog No. RP107831
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107831 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107831 Supplier Invitrogen™ Supplier No. RP107831

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67192 (PA5-67192. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SAPCD1 is a protein coding gene.

Specifications

Accession Number Q5SSQ6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 401251
Name Human SAPCD1 (aa 47-118) Control Fragment
Quantity 100 μL
Gene Alias 2810436B06Rik; C23H6orf26; C6orf26; G7d; Ng23; Protein G7d; Sapcd1; suppressor APC domain containing 1; suppressor APC domain-containing protein 1
Common Name SAPCD1
Gene Symbol SAPCD1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence REQDALWQGLELLQHGQAWFEDHLREAQRQQLHLGALGENFLTDLHSEPGRPPLAQIQKVNICLQNLIHEKE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less