missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human SAPAP4 (aa 692-772) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP99293
Description
Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62919 (PA5-62919. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
SAP90/PSD-95-associated protein 4 (SAPAP4, also known as DLGAP4) is a member of a protein family whose members specifically interact with PSD-95/SAP90, a membrane-associated guanylate kinase localized at postsynaptic density (PSD) in neuronal cells. Like the other SAPAP proteins, SAPAP4 is thought to be an adaptor protein that also interacts with different synaptic scaffolding proteins, cytoskeletal and signaling components, such as focal adhesion kinase (FAK) and proline-rich tyrosine kinase 2 (PYK2). SAPAP4 mRNA is targeted to cell bodies in a similar manner to SAPAP1 and -2, whereas SAPAP3 mRNA is detected mainly in cell bodies.Specifications
| Q9Y2H0 | |
| Blocking Assay, Control | |
| 22839 | |
| 100 μL | |
| AI225853; BC024558; Dap4; DAP-4; discs large homolog associated protein 4; discs, large (Drosophila) homolog-associated protein 4; discs, large homolog-associated protein 4; discs, large homolog-associated protein 4 (Drosophila); disks large-associated protein 4; DLG associated protein 4; Dlgap4; DLP4; Kiaa0964; PSD-95/SAP90-associated protein-4; PSD-95/SAP90-binding protein 4; RP5-977B1.6; SAP90/PSD-95-associated protein 4; Sapap4; SAPAP-4; WBP16; WW domain-binding protein 16 | |
| DLGAP4 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human SAPAP4 (aa 692-772) Control Fragment | |
| RUO | |
| SAPAP4 | |
| Unconjugated | |
| Recombinant | |
| GVQVEDDWRSSVPSHSMSSRRDTDSDTQDANDSSCKSSERSLPDCTPHPNSISIDAGPRQAPKIAQIKRNLSYGDNSDPAL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |