missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91647

Invitrogen™ Human SALL3 (aa 784-871) Control Fragment Recombinant Protein

Catalog No. RP91647
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91647 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91647 Supplier Invitrogen™ Supplier No. RP91647
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53467 (PA5-53467. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SALL3 belongs to the sal C2H2-type zinc-finger protein family. It contains 9 C2H2-type zinc fingers. SALL3 is a probable transcription factor.

Specifications

Accession Number Q9BXA9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 27164
Name Human SALL3 (aa 784-871) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias B130022O04Rik; C2H2 zinc finger protein SALL3; hSALL3; MSal; Msal-1; Sal; Sall3; sal-like 3; sal-like 3 (Drosophila); sal-like protein 3; Salt; Spalt; spalt like transcription factor 3; spalt-like protein 3; spalt-like transcription factor 3; spalt-like zinc finger protein; zinc finger protein 796; Zinc finger protein SALL3; ZNF796
Common Name SALL3
Gene Symbol SALL3
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AYDDKNAETLSSYDDDMDENSMEDDAELKDAATDPAKPLLSYAGSCPPSPPSVISSIAALENQMKMIDSVMSCQQLTGLKSVENGSGE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less