missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP99109

Invitrogen™ Human SAE1 (aa 61-137) Control Fragment Recombinant Protein

Catalog No. RP99109
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99109 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99109 Supplier Invitrogen™ Supplier No. RP99109

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83666 (PA5-83666. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2. form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999).

Specifications

Accession Number Q9UBE0
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10055
Name Human SAE1 (aa 61-137) Control Fragment
Quantity 100 μL
Gene Alias 2400010M20Rik; 2610044L12Rik; activator of SUMO1; AL033372; AOS1; AW743391; D7Ertd177e; FLJ3091; HSPC140; Sae1; sentrin/SUMO-activating protein AOS1; Sua1; SUMO-1 activating enzyme E1 N subunit; SUMO1 activating enzyme subunit 1; SUMO-1 activating enzyme subunit 1; SUMO-activating enzyme subunit 1; SUMO-activating enzyme subunit 1, N-terminally processed; ubiquitin-like (sentrin) activating enzyme E1A; ubiquitin-like 1 (sentrin) activating enzyme E1A; ubiquitin-like 1 (sentrin) activating enzyme subunit 1; ubiquitin-like 1-activating enzyme E1A; ubiquitin-like protein SUMO-1 activating enzyme; Ubl1a1; Uble1a
Common Name SAE1
Gene Symbol SAE1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KGLTMLDHEQVTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less