missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP97227

Invitrogen™ Human RUFY2 (aa 407-461) Control Fragment Recombinant Protein

Catalog No. RP97227
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97227 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97227 Supplier Invitrogen™ Supplier No. RP97227

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58931 (PA5-58931. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RUFY2 (RUN And FYVE Domain Containing 2) is a Protein Coding gene. An important paralog of this gene is RUNDC3B.

Specifications

Accession Number Q8WXA3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 55680
Name Human RUFY2 (aa 407-461) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2610111M19Rik; AI844453; antigen MU-RMS-40.17; Denn; Kiaa1537; Leucine zipper FYVE-finger protein; LZ-FYVE; Rab4-interacting protein related; RABIP4R; RUFY2; RUN and FYVE domain containing 2; RUN and FYVE domain-containing 2; RUN and FYVE domain-containing protein 2; Run- and FYVE-domain containing protein; ZFYVE13
Common Name RUFY2
Gene Symbol RUFY2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence EKAQMEAEDEDEKYLQECLSKSDSLQKQISQKEKQLVQLETDLKIEKEWRQTLQE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less