missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human RTN1 (aa 193-281) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP105995
Description
Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83526 (PA5-83526. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Reticulon-1 was formerly designated NSP for Neuroendocrine-Specific-Protein, because it is specifically expressed in neural and neuroendocrine tissues. The NSP-gene has been mapped by fluorescence in situ hybridization to human chromosome 14q21-q22. The NSP-gene encodes three overlapping proteins, i.e. reticulon-1A (NSP-A), reticulon-1B (NSP-B), and reticulon-1C (NSP-C). These proteins were found to be anchored to membranes of the endoplasmic reticulum through their common carboxy-terminal regions. Reticulon-1A is a protein with a molecular weight of approximately 135 kDa, which occurs in various isoforms presumably depending on the degree of phosphorylation of serine residues. In lung cancer diagnosis Reticulon-1A appeared to be a reliable marker for the detection of neuroendocrine differentiation, since most of the small cell lung carcinoma (SCLC) and carcinoid tumors showed expression of Reticulon-1A. Reticulon-1B is a phosphoprotein with a MW of 45 kDa and is restricted to the lung cancer cell line NCI-H82. Reticulon-1B is so far not found in human tissues. Reticulon-1C is a protein with a MW of 23 kDa which is not phosphorylated and is found with Reticulon-1A in SCLC (cell lines) and not in non-SCLC (cell cultures).Specifications
| Q16799 | |
| Blocking Assay, Control | |
| 6252 | |
| 100 μL | |
| 0710005K15Rik; 4930441F12Rik; I79_024631; LOC100750648; MGC133250; MGC40985; Neuroendocrine-specific protein; Nsp; R75279; reticulon 1; reticulon-1; RP23-450G14.1; RTN1; Rtn1-a; Rtn1-b; Rtn1-c; S-rex | |
| RTN1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human RTN1 (aa 193-281) Control Fragment | |
| RUO | |
| RTN1 | |
| Unconjugated | |
| Recombinant | |
| AYKYIDITRPEEVKHQEQHHPELEDKDLDFKNKDTDISIKPEGVREPDKPAPVEGKIIKDHLLEESTFAPYIDDLSEEQRRAPQITTPV | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |