missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RTN1 (aa 193-281) Control Fragment Recombinant Protein

Catalog No. RP105995
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105995 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105995 Supplier Invitrogen™ Supplier No. RP105995
Only null left

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83526 (PA5-83526. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Reticulon-1 was formerly designated NSP for Neuroendocrine-Specific-Protein, because it is specifically expressed in neural and neuroendocrine tissues. The NSP-gene has been mapped by fluorescence in situ hybridization to human chromosome 14q21-q22. The NSP-gene encodes three overlapping proteins, i.e. reticulon-1A (NSP-A), reticulon-1B (NSP-B), and reticulon-1C (NSP-C). These proteins were found to be anchored to membranes of the endoplasmic reticulum through their common carboxy-terminal regions. Reticulon-1A is a protein with a molecular weight of approximately 135 kDa, which occurs in various isoforms presumably depending on the degree of phosphorylation of serine residues. In lung cancer diagnosis Reticulon-1A appeared to be a reliable marker for the detection of neuroendocrine differentiation, since most of the small cell lung carcinoma (SCLC) and carcinoid tumors showed expression of Reticulon-1A. Reticulon-1B is a phosphoprotein with a MW of 45 kDa and is restricted to the lung cancer cell line NCI-H82. Reticulon-1B is so far not found in human tissues. Reticulon-1C is a protein with a MW of 23 kDa which is not phosphorylated and is found with Reticulon-1A in SCLC (cell lines) and not in non-SCLC (cell cultures).

Specifications

Accession Number Q16799
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6252
Name Human RTN1 (aa 193-281) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 0710005K15Rik; 4930441F12Rik; I79_024631; LOC100750648; MGC133250; MGC40985; Neuroendocrine-specific protein; Nsp; R75279; reticulon 1; reticulon-1; RP23-450G14.1; RTN1; Rtn1-a; Rtn1-b; Rtn1-c; S-rex
Common Name RTN1
Gene Symbol RTN1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence AYKYIDITRPEEVKHQEQHHPELEDKDLDFKNKDTDISIKPEGVREPDKPAPVEGKIIKDHLLEESTFAPYIDDLSEEQRRAPQITTPV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less