missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. RP109409

Invitrogen™ Human RRP12 (aa 718-803) Control Fragment Recombinant Protein

Catalog No. RP109409
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP109409 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP109409 Supplier Invitrogen™ Supplier No. RP109409
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RRP12 (Ribosomal RNA Processing 12 Homolog) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene includebinding.

Specifications

Accession Number Q5JTH9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23223
Name Human RRP12 (aa 718-803) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA408556; AA536972; Kiaa0690; mKIAA0690; ribosomal RNA processing 12 homolog; ribosomal RNA processing 12 homolog (S. cerevisiae); Rrp12; RRP12-like protein
Common Name RRP12
Gene Symbol RRP12
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RTYLTITDTQLVNSLLEKASEKVLDPASSDFTRLSVLDLVVALAPCADEAAISKLYSTIRPYLESKAHGVQKKAYRVLEEVCASPQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less