missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human RRN3 (aa 598-638) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP101123
Description
Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62060 (PA5-62060. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Required for efficient transcription initiation by RNA polymerase I. Required for the formation of the competent preinitiation complex (PIC). Dissociates from pol I as a consequence of transcription. In vitro, cannot activate transcription in a subsequent transcription reaction.Specifications
| Q9NYV6 | |
| Blocking Assay, Control | |
| 54700 | |
| 100 μL | |
| A-270G1.2; AL023001; E130302O19Rik; R75565; RGD1305001; RNA polymerase I-specific transcription initiation factor RRN3; Rrn3; RRN3 homolog, RNA polymerase I transcription factor; RRN3 RNA polymerase I transcription factor homolog; RRN3 RNA polymerase I transcription factor homolog (S. cerevisiae); RRN3 RNA polymerase I transcription factor homolog (yeast); Tif1a; TIF-1 A; TIFIA; TIF-IA; Transcription initiation factor IA; transcription initiation factor TIF-IA | |
| RRN3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human RRN3 (aa 598-638) Control Fragment | |
| RUO | |
| RRN3 | |
| Unconjugated | |
| Recombinant | |
| KDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSSSV | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |