missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104160

Invitrogen™ Human RRM1 (aa 16-130) Control Fragment Recombinant Protein

Catalog No. RP104160
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104160 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104160 Supplier Invitrogen™ Supplier No. RP104160

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RRM1 (Ribonucleotide reductase M1 polypeptide) is one of two non-identical subunits that constitute ribonucleoside-diphosphate reductase, an enzyme which catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. It provides the precursors necessary for DNA synthesis. RRM1 is involved in carcinogenesis, tumor progression.

Specifications

Accession Number P23921
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 6240
Name Human RRM1 (aa 16-130) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias cb396; cb838; CHUNP6866; hypothetical protein; R RRM 1; r1; RI RI RR 1; Ribonucleoside-diphosphate reductase large subunit; ribonucleoside-diphosphate reductase M1 chain; ribonucleoside-diphosphate reductase subunit M1; ribonucleotide reductase catalytic subunit M1; ribonucleotide reductase large subunit; ribonucleotide reductase M1; ribonucleotide reductase M1 L homeolog; ribonucleotide reductase M1 polypeptide; ribonucleotide reductase M1 S homeolog; ribonucleotide reductase protein R1 class I; ribonucleotide reductase subunit M1; ribonucleotide reductase, R1 subunit; RIR 1; RIR1; RnrM1; RR1; Rrm1; rrm1 protein; rrm1.L; rrm1.S; sb:cb548; wu:fb39b07; wu:fi14b02; wu:fk95f07; XELAEV_18013932mg; XRRM1
Common Name RRM1
Gene Symbol RRM1
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DKITSRIQKLCYGLNMDFVDPAQITMKVIQGLYSGVTTVELDTLAAETAATLTTKHPDYAILAARIAVSNLHKETKKVFSDVMEDLYNYINPHNGKHSPMVAKSTLDIVLANKDR
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less