missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP106312

Invitrogen™ Human RP9 (aa 97-170) Control Fragment Recombinant Protein

Catalog No. RP106312
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106312 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106312 Supplier Invitrogen™ Supplier No. RP106312

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65641 (PA5-65641. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Is thought to be a target protein for the PIM1 kinase. May play some roles in B-cell proliferation in association with PIM1.

Specifications

Accession Number Q8TA86
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6100
Name Human RP9 (aa 97-170) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias LOW QUALITY PROTEIN: retinitis pigmentosa 9 protein; PAP1; PAP-1; Pim-1 associated protein; Pim-1 kinase associated protein; pim-1-associated protein; retinitis pigmentosa 9 (autosomal dominant); retinitis pigmentosa 9 (human); retinitis pigmentosa 9 homolog; retinitis pigmentosa 9 protein; Retinitis pigmentosa 9 protein homolog; RGD1559759; RP9; RP9 pre-mRNA splicing factor; Rp9h
Common Name RP9
Gene Symbol RP9
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GKEVKVMQCWRCKRYGHRTGDKECPFFIKGNQKLEQFRVAHEDPMYDIIRDNKRHEKDVRIQQLKQLLEDSTSD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less