Learn More
Invitrogen™ Human RP2 (aa 183-301) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP91928
Description
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-51363 (PA5-51363, PA5-64873 (PA5-64873. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding.Specifications
| O75695 | |
| Blocking Assay, Control | |
| 6102 | |
| 100 μL | |
| AI662636; DELXp11.3; KIAA0215; NM23-H10; NME10; Protein XRP2; retinitis pigmentosa 2 (X-linked recessive); retinitis pigmentosa 2 homolog (human); RGD1565124; Rp2; RP2 activator of ARL3 GTPase; RP2, ARL3 GTPase activating protein; Rp2h; TBCCD2; XRP2; XRP2 protein | |
| RP2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human RP2 (aa 183-301) Control Fragment | |
| RUO | |
| RP2 | |
| Unconjugated | |
| Recombinant | |
| ELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |