missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP91928

Invitrogen™ Human RP2 (aa 183-301) Control Fragment Recombinant Protein

Catalog No. RP91928
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP91928 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP91928 Supplier Invitrogen™ Supplier No. RP91928
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-51363 (PA5-51363, PA5-64873 (PA5-64873. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The RP2 locus has been implicated as one cause of X-linked retinitis pigmentosa. The predicted gene product shows homology with human cofactor C, a protein involved in the ultimate step of beta-tubulin folding.

Specifications

Accession Number O75695
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6102
Name Human RP2 (aa 183-301) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AI662636; DELXp11.3; KIAA0215; NM23-H10; NME10; Protein XRP2; retinitis pigmentosa 2 (X-linked recessive); retinitis pigmentosa 2 homolog (human); RGD1565124; Rp2; RP2 activator of ARL3 GTPase; RP2, ARL3 GTPase activating protein; Rp2h; TBCCD2; XRP2; XRP2 protein
Common Name RP2
Gene Symbol RP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALE
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less