missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105130

Invitrogen™ Human RNF23 (aa 415-458) Control Fragment Recombinant Protein

Catalog No. RP105130
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105130 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105130 Supplier Invitrogen™ Supplier No. RP105130

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66259 (PA5-66259. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The function of this protein has not been identified. This gene lies within the major histocompatibility complex class I region on chromosome 6. Alternate splicing results in two transcript variants encoding different isoforms.

Specifications

Accession Number Q9HCM9
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 56658
Name Human RNF23 (aa 415-458) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1100001D15Rik; E130103K13Rik; E3 ubiquitin-protein ligase TRIM39; mKIAA4179; RBCC-B30.2; ring finger protein 23; RING-B box-coiled coil-B30.2; RING-B box-coiled-coil-B30.2; RING-type E3 ubiquitin transferase TRIM39; Rnf23; Testis-abundant finger protein; tfp; TRIM39; TRIM39B; tripartite motif containing 39; tripartite motif protein 39; tripartite motif-containing 39; tripartite motif-containing protein 39
Common Name RNF23
Gene Symbol TRIM39
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRV
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less