missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human RNF113A (aa 44-154) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP91953
Description
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51355 (PA5-51355. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This intronless gene encodes a protein which contains a C3H1-type zinc finger domain and a C3HC4 Ring-type (Really Interesting New Gene-type) zinc finger domain. The Ring-type zinc finger domain is identified in various tumor suppressors, DNA repair genes and cytokine receptor-associated molecules, and is probably involved in mediating protein-protein interactions. [provided by RefSeq, May 2010].Specifications
| O15541 | |
| Blocking Assay, Control | |
| 7737 | |
| 100 μL | |
| 2810428C21Rik; Cwc24; Cwc24 homolog; E3 ubiquitin-protein ligase RNF113A; RING finger protein 113 A; ring finger protein 113A1; RNF113; RNF113A; Rnf113a1; TTD5; Zinc finger protein 183; zinc finger protein 183 (RING finger, C3HC4 type); ZNF183 | |
| RNF113A | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human RNF113A (aa 44-154) Control Fragment | |
| RUO | |
| RNF113A | |
| Unconjugated | |
| Recombinant | |
| GSSSDEGCTVVRPEKKRVTHNPMIQKTRDSGKQKAAYGDLSSEEEEENEPESLGVVYKSTRSAKPVGPEDMGATAVYELDTEKERDAQAIFERSQKIQEELRGKEDDKIYR | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |