missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105159

Invitrogen™ Human RMND5A (aa 9-71) Control Fragment Recombinant Protein

Catalog No. RP105159
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105159 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105159 Supplier Invitrogen™ Supplier No. RP105159

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84471 (PA5-84471. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RMND5A is a protein coding gene.

Specifications

Accession Number Q9H871
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 64795
Name Human RMND5A (aa 9-71) Control Fragment
Quantity 100 μL
Gene Alias 1110007A06Rik; 44-kD protein coding for CTLH motif; AJ237586; AW125795; C-terminal to LisH motif, 44 kDa; CTLH; E3 ubiquitin-protein ligase RMND5A; E3 ubiquitin-protein transferase RMND5A; FLJ13910; GID complex subunit 2 homolog A; GID2; GID2A; MTA.D02.090; p44CTLH; Protein RMD5 homolog A; required for meiotic nuclear division 5 homolog A; required for meiotic nuclear division 5 homolog A (S. cerevisiae); RGD1309766; RMD5; RMND5A
Common Name RMND5A
Gene Symbol RMND5A
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RELEKVLHKFSGYGQLCERGLEELIDYTGGLKHEILQSHGQDAELSGTLSLVLTQCCKRIKDT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less