missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98271

Invitrogen™ Human RKHD2 (aa 462-546) Control Fragment Recombinant Protein

Catalog No. RP98271
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98271 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98271 Supplier Invitrogen™ Supplier No. RP98271
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59220 (PA5-59220. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Rkhd2, also known as MEX3C is a member of a novel family of four homologous human MEX3 proteins each containing two heterogeneous nuclear ribonucleoprotein K homology (KH) domains and one carboxy-terminal RING finger module. MEX3 proteins, including Rkhd2, are phosphoproteins that bind RNA through their KH domains and shuttle between the nucleus and the cytoplasm via the CRM1 export pathway. These proteins are a novel family of evolutionarily conserved RNA-binding proteins, differentially recruited to P bodies and potentially involved in post-transcriptional regulatory mechanisms. It has been suggested that genetic variations in Rkhd2 may be associated with susceptibility to essential hypertension type 8. Rkhd3 and Rkhd4, but not Rkhd2, co-localize with both the hDcp1a decapping factor and Argonaute (Ago) proteins in processing bodies (P bodies), recently characterized as centers of mRNA turnover.

Specifications

Accession Number Q5U5Q3
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51320
Name Human RKHD2 (aa 462-546) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias A130001D14Rik; BC035207; BM-013; mex-3 homolog C; me x 3 homolog C (C. elegans); mex-3 RNA binding family member C; Me x 3 c; MEX-3 C; ME x 3 C variant 1; ME x 3 C variant 10; ME x 3 C variant 11; ME x 3 C variant 2; ME x 3 C variant 3; ME x 3 C variant 4; ME x 3 C variant 5; ME x 3 C variant 6; ME x 3 C variant 9; ring finger and KH domain containing 2; RING finger and KH domain-containing protein 2; RING finger protein 194; RING-type E3 ubiquitin transferase ME x 3 C; Rkhd2; RNA-binding E3 ubiquitin-protein ligase ME x 3 C; RNA-binding protein ME x 3 C; RNF194
Common Name RKHD2
Gene Symbol MEX3C
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence NRLADFSPTSPFSTGNFWFGDTLPSVGSEDLAVDSPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRRGSQPSTPRLSP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less