missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96524

Invitrogen™ Human RIN1 (aa 692-773) Control Fragment Recombinant Protein

Catalog No. RP96524
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96524 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96524 Supplier Invitrogen™ Supplier No. RP96524

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (39%), Rat (39%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57292 (PA5-57292. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Rit and its neuron-specific homologue, Rin, define a recently discovered subfamily of Ras-related GTPases. Rit and Rin are membrane-associated in spite of the fact that they lack a CAAX box or similar C-terminal lipidation motif. Rit and Rin display 64% amino acid sequence identity and share a unique nine amino acid effector domain (DPTIEDAYK) that is 100% conserved between the murine and human proteins. Although the effector domain sequences of Rit and Rin are very similar to that of Ras, Rit and Rin have been shown to interact with the known Ras-binding proteins RalGDS, Rlf and AF-6, but not the Raf kinases, RIN1 or the p110 subunit of PI3 kinase. For this reason, it has been suggested that Rit and Rin may play important roles in the regulation of signaling pathways distinct from those controlled by Ras.

Specifications

Accession Number Q13671
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9610
Name Human RIN1 (aa 692-773) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Ras and Rab interactor 1; ras inhibitor; ras inhibitor 1; ras inhibitor JC99; ras inhibitor RIN1; ras interaction/interference protein 1; RIBA; Rin1; RIT2; ROC2
Common Name RIN1
Gene Symbol RIN1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RLPTTGYLVYRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETTAEGGQGQAQEGPAQPGEP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less