missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Rhotekin (aa 307-425) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP92032
Description
Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56418 (PA5-56418. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms.Specifications
| Q9BST9 | |
| Blocking Assay, Control | |
| 6242 | |
| 100 μL | |
| hypothetical protein LOC539691; RGD:727874}; rhotekin; RTKN; rtkn {ECO:0000312; RTKN1 | |
| RTKN | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Rhotekin (aa 307-425) Control Fragment | |
| RUO | |
| Rhotekin | |
| Unconjugated | |
| Recombinant | |
| MTQPTASGTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEEPLLTIAVNKETRVRAGELDQALGRPFTLSISNQYGDDEVTHTLQTESREALQSWMEALWQLFFDMSQWKQCC | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |