missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105726

Invitrogen™ Human Rhodopsin (aa 1-38) Control Fragment Recombinant Protein

Catalog No. RP105726
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105726 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105726 Supplier Invitrogen™ Supplier No. RP105726
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110783 (PA5-110783. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Visual pigments such as rhodopsin and porphyropsin are light-absorbing molecules that mediate vision. Rhodopsin consists of an apoprotein, opsin, covalently linked to 11-cis-retinal. This receptor is coupled to the activation of phospholipase C. Porphyropsin consists of opsin covalently linked to 11-cis 3,4-didehydroretinal.

Specifications

Accession Number P08100
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 6010
Name Human Rhodopsin (aa 1-38) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias CSNBAD1; L opsin; Long Wavelength Sensitive opsin; LWS opsin; MGC138309; MGC138311; Noerg1; OPN 2; Opn2; Ops; opsin 2; opsin 2, rod pigment; opsin-2; Red Opsin; retinal rod opsin pigment rh1.1; Rh; RH1; rh1.1; rho; rho protein; rhodopsin; rhodopsin (opsin 2, rod pigment) (retinitis pigmentosa 4, autosomal dominant); Rhodopsin (retinitis pigmentosa 4, autosomal dominant); rhodopsin-like-1.1 rod opsin; Rod Opsin; RP 4; RP4; seven transmembrane light receptor; unknown opsin-like protein; wu:fi06d11; zfo2; zfrho
Common Name Rhodopsin
Gene Symbol RHO
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MNGTEGPNFYVPFSNATGVVRSPFEYPQYYLAEPWQFS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less