missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP101979

Invitrogen™ Human RhoBTB2 (aa 531-581) Control Fragment Recombinant Protein

Catalog No. RP101979
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP101979 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP101979 Supplier Invitrogen™ Supplier No. RP101979
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84472 (PA5-84472. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RHOBTB2 is a member of the evolutionarily conserved RHOBTB subfamily of Rho GTPases. For background information on RHOBTBs, see RHOBTB1.

Specifications

Accession Number Q9BYZ6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 23221
Name Human RhoBTB2 (aa 531-581) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Dbc2; Deleted in breast cancer 2 gene protein; deleted in breast cancer 2 gene protein homolog; E130206H14Rik; KIAA0717; KIAA0740; mKIAA0717; p83; Rho related BTB domain containing 2; Rho related BTB domain containing protein 2; RHOBTB1; RHOBTB2; Rho-related BTB domain containing 2; rho-related BTB domain-containing protein 2
Common Name RhoBTB2
Gene Symbol RHOBTB2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence GPFVESSTREVVFPYTSKSCMRAVLEYLYTGMFTSSPDLDDMKLIILANRL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less