missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98469

Invitrogen™ Human RHCG (aa 31-61) Control Fragment Recombinant Protein

Catalog No. RP98469
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98469 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98469 Supplier Invitrogen™ Supplier No. RP98469
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60320 (PA5-60320. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RHCG (Rhesus blood group family type C glycoprotein), also known as RHGK (Rh glycoprotein kidney), PDRC2 (tumor-related protein DRC2) or SLC42A3, is a multi-pass membrane protein with three potential N-glycosylation sites that belongs to the Rh subfamily of the ammonium transporter family. Expressed in a wide variety of tissues with predominant expression in adult and fetal kidney, RHCg localizes to the apical and/or basolateral cell membrane (depending on the species) and is believed to function as a non-erythroid, bidirectional, electroneutral ammonium transporter.

Specifications

Accession Number Q9UBD6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51458
Name Human RHCG (aa 31-61) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias ammonium transporter Rh type C; BB065800; C15orf6; CDRC2; PDRC2; Rh family; Rh family C glycoprotein; rh family type C glycoprotein; Rh family, C glycoprotein; rh glycoprotein kidney; Rh type C glycoprotein; RHCG; Rhesus blood group family type C glycoprotein; Rhesus blood group, C glycoprotein; Rhesus blood group-associated C glycoprotein; Rhesus-associated C glycoprotein; RHGK; SLC42A3; Tumor-related protein DRC2
Common Name RHCG
Gene Symbol RHCG
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence RYDFEADAHWWSERTHKNLSDMENEFYYRYP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less