missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP104559

Invitrogen™ Human RGS2 (aa 121-198) Control Fragment Recombinant Protein

Catalog No. RP104559
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP104559 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP104559 Supplier Invitrogen™ Supplier No. RP104559

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 2 belongs to this family. The protein acts as a mediator of myeloid differentiation and may play a role in leukemogenesis.

Specifications

Accession Number P41220
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5997
Name Human RGS2 (aa 121-198) Control Fragment
Quantity 100 μL
Gene Alias cell growth-inhibiting gene 31 protein; cell growth-inhibiting protein 31; G0 to G1 switch regulatory 8, 24 kD; G0/G1 switch regulatory protein 8; G0S8; GIG31; GOS8; regulator of G protein signaling 2; regulator of G protein signaling 2; regulator of G-protein signaling 2; regulator of G-protein signaling 2; regulator of G-protein signaling 2, 24 kDa; regulator of G-protein signaling protein 2; regulator of G-protein signalling 2, 24 kDa; Rgs2
Common Name RGS2
Gene Symbol RGS2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDL
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less