missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP108857

Invitrogen™ Human RFPL2 (aa 1-60) Control Fragment Recombinant Protein

Catalog No. RP108857
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP108857 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP108857 Supplier Invitrogen™ Supplier No. RP108857

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (25%), Rat (25%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RFPL1, RFPL2 and RFPL3 (ret finger protein-like 1, 2 and 3, respectively), exist as a cluster of genes mapping to human chromosome 22q12.2-q13.3, sharing 95%-96% identity. RFPL1, 2 and 3, are thought to contribute to neocortex organization and size in primates, and show high expression in fetal neocortex as well as embryonic stem-cell neurogenesis. Each of the three RFPL genes encodes two exons giving rise to a putative RING-like motifs and B30-2 domains. RFPL2, or RNF79, is 378 amino acids long and is also highly expressed in prostate with lower expression in fetal kidney and fetal liver. As a result of alternative splicing, two isoforms of RFPL2 exist.

Specifications

Accession Number O75678
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 10739
Name Human RFPL2 (aa 1-60) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias ret finger protein like 2; ret finger protein-like 2; RFPL2; RING finger protein 79; RNF79
Common Name RFPL2
Gene Symbol RFPL2
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence MEVAELGFPETAVSQSRICLCAVLCGHWDFADMMVIRSLSLIRLEGVEGRDPVGGGNLTN
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less