missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98443

Invitrogen™ Human RERG (aa 61-119) Control Fragment Recombinant Protein

Catalog No. RP98443
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98443 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98443 Supplier Invitrogen™ Supplier No. RP98443
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59545 (PA5-59545. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RERG, a member of the RAS superfamily of GTPases, inhibits cell proliferation and tumor formation.

Specifications

Accession Number Q96A58
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 85004
Name Human RERG (aa 61-119) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias MGC15754; RAS like estrogen regulated growth inhibitor; RAS-like; RAS-like, estrogen-regulated, growth inhibitor; RAS-like, estrogen-regulated, growth-inhibitor; ras-related and estrogen-regulated growth inhibitor; ras-related and estrogen-regulated growth protein; RERG; RGD1562829; si:cabz01085950.1
Common Name RERG
Gene Symbol RERG
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence TAGQEDTIQREGHMRWGEGFVLVYDITDRGSFEEVLPLKNILDEIKKPKNVTLILVGNK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less