missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP107834

Invitrogen™ Human RECK (aa 419-494) Control Fragment Recombinant Protein

Catalog No. RP107834
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP107834 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP107834 Supplier Invitrogen™ Supplier No. RP107834

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111679 (PA5-111679. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RECK is a cysteine-rich, extracellular protein with protease inhibitor-like domains whose expression is suppressed strongly in many tumors and cells transformed by various kinds of oncogenes. In normal cells, this membrane-anchored glycoprotein may serve as a negative regulator for matrix metalloproteinase-9, a key enzyme involved in tumor invasion and metastasis.

Specifications

Accession Number O95980
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 8434
Name Human RECK (aa 419-494) Control Fragment
Quantity 100 μL
Gene Alias hRECK; membrane-anchored glycoprotein (metastasis and invasion); membrane-anchored glycoprotein RECK; mRECK; RECK; reversion inducing cysteine rich protein with kazal motifs; reversion-inducing cysteine-rich protein with Kazal motifs; Reversion-inducing cysteine-rich protein with Kazal motifs precursor (mRECK); reversion-inducing-cysteine-rich protein with kazal motifs; ST15; suppression of tumorigenicity 15; suppression of tumorigenicity 15 (reversion-inducing-cysteine-rich protein with kazal motifs); suppression of tumorigenicity 5 (reversion-inducing-cysteine-rich protein with kazal motifs); suppressor of tumorigenicity 15 protein
Common Name RECK
Gene Symbol RECK
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence IKPCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRPSTLGNIVEEVTHPC
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less