missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human RCC2 (aa 448-518) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP103716
Description
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Required for completion of mitosis and cytokinesis. May function as a guanine nucleotide exchange factor for the small GTPase RAC1.Specifications
| Q9P258 | |
| Blocking Assay, Control | |
| 55920 | |
| 100 μL | |
| 2610510H01Rik; 2610529N02Rik; AA536646; AA675016; KIAA1470; mKIAA1470; protein RCC2; Protein RCC2 homolog; RCC1-like; RCC1-like protein TD-60; RCC2; regulator of chromosome condensation 2; RGD1309986; Td60; td-60; Telophase disk protein of 60 kDa; wu:fb36a03; zgc:77115 | |
| RCC2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human RCC2 (aa 448-518) Control Fragment | |
| RUO | |
| RCC2 | |
| Unconjugated | |
| Recombinant | |
| ESTISWGPSPTFGELGYGDHKPKSSTAAQEVKTLDGIFSEQVAMGYSHSLVIARDESETEKEKIKKLPEYN | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |