missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human RBMY1A1 (aa 1-122) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP104305
Description
Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51595 (PA5-51595. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
RBMY1A1 is a protein containing an RNA-binding motif in the N-terminus and four SRGY (serine, arginine, glycine, tyrosine) boxes in the C-terminus. This protein is thought to function as a splicing regulator during spermatogenesis. Multiple closely related paralogs of this gene are found in a gene cluster in the AZFb azoospermia factor region of chromosome Y. Most of these related copies are thought to be pseudogenes, though several likely encode functional proteins.Specifications
| P0DJD3 | |
| Blocking Assay, Control | |
| 5940 | |
| 100 μL | |
| hRBMY; RBM; RBM1; RBM2; RBMY; RBMY1A1; RBMY1C; RNA binding motif protein, Y-linked, family 1, member A1; RNA-binding motif protein 1; RNA-binding motif protein 2; RNA-binding motif protein, Y chromosome, family 1 member A1; RNA-binding motif protein, Y chromosome, family 1 member A1/C; Y chromosome RNA recognition motif 1; Y chromosome RNA recognition motif 2; YRRM1; YRRM2 | |
| RBMY1A1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human RBMY1A1 (aa 1-122) Control Fragment | |
| RUO | |
| RBMY1A1 | |
| Unconjugated | |
| Recombinant | |
| MVEADHPGKLFIGGLNRETNEKMLKAVFGKHGPISEVLLIKDRTSKSRGFAFITFENPADAKNAAKDMNGKSLHGKAIKVEQAKKPSFQSGGRRRPPASSRNRSPSGSLRSARGSRGGTRGW | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |