missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP105208

Invitrogen™ Human RBMS1 (aa 302-333) Control Fragment Recombinant Protein

Catalog No. RP105208
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP105208 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP105208 Supplier Invitrogen™ Supplier No. RP105208
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84516 (PA5-84516. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis. Several transcript variants, resulting from alternative splicing and encoding different isoforms, have been described. A pseudogene for this locus is found on chromosome 12.

Specifications

Accession Number P29558
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5937
Name Human RBMS1 (aa 302-333) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 2600014B10Rik; AI255215; C2orf12; cervical cancer oncogene 4; c-myc gene single strand binding protein 2; EMBL:AAH87094.1}; HCC-4; hypothetical protein LOC526135; MSSP; MSSP1; MSSP-1; MSSP-2; MSSP-3; Rbms1; rbms1 {ECO:0000312; RNA binding motif single stranded interacting protein 1; RNA binding motif, single stranded interacting protein 1; RNA-binding motif, single-stranded-interacting protein 1; SCR2; Single-stranded DNA-binding protein MSSP-1; suppressor of cdc 2 (cdc13) with RNA binding motif 2; suppressor of CDC2 with RNA-binding motif 2; YC1
Common Name RBMS1
Gene Symbol RBMS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence QSPSWMQPQPYILQHPGAVLTPSMEHTMSLQP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less