missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RASSF9 (aa 357-435) Control Fragment Recombinant Protein

Catalog No. RP97893
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP97893 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP97893 Supplier Invitrogen™ Supplier No. RP97893

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58785. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene localizes to perinuclear endosomes. This protein associates with peptidylglycine alpha-amidating monooxygenase, and may be involved with the trafficking of this enzyme through secretory or endosomal pathways.

Specifications

Accession Number O75901
Concentration ≥5.0 mg/mL
For Use With (Application) Neutralization, Control
Formulation PBS, 1M urea with no preservative; pH 7.4
Gene ID (Entrez) 9182
Name Human RASSF9 (aa 357-435) Control Fragment
pH Range 7.4
Purification Method Purified
Quantity 100 μL
Storage Requirements -20°C, Avoid Freeze/Thaw Cycles
Regulatory Status RUO
Gene Alias AW322107; PAM COOH-terminal interactor protein 1; Pamci; PCIP1; P-cip1; Peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor; peptidylglycine alpha-amidating monooxygenase COOH-terminal interactor protein-1; Ras association (RalGDS/AF-6) domain family (N-terminal) member 9; Ras association domain family member 9; ras association domain-containing protein 9; RASSF9
Common Name RASSF9
Gene Symbol RASSF9
Product Type Protein
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence YELLAKEFNSLHISNKDGCQLKENRAKESEVPSSNGEIPPFTQRVFSNYTNDTDSDTGISSNHSQDSETTVGDVVLLST
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less