missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP98331

Invitrogen™ Human RASSF1 (aa 90-162) Control Fragment Recombinant Protein

Catalog No. RP98331
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP98331 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP98331 Supplier Invitrogen™ Supplier No. RP98331
Only null left

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59273 (PA5-59273. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein similar to the RAS effector proteins. Loss or altered expression of this gene has been associated with the pathogenesis of a variety of cancers, which suggests the tumor suppressor function of this gene. The inactivation of this gene was found to be correlated with the hypermethylation of its CpG-island promoter region. The encoded protein was found to interact with DNA repair protein XPA. The protein was also shown to inhibit the accumulation of cyclin D1, and thus induce cell cycle arrest. Seven alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.

Specifications

Accession Number Q9NS23
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 11186
Name Human RASSF1 (aa 90-162) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 123 F protein; 123F2; AA536941; AU044980; cardiac-specific ras association domain family 1 protein; NORE2A; pancreas-specific ras association domain family 1 protein; protein 123F2; Ras association (RalGDS/AF-6) domain family 1; Ras association (RalGDS/AF-6) domain family member 1; Ras association domain family 1; Ras association domain family member 1; ras association domain-containing protein 1; Rassf1; Rassf1A; RASSF1A tumor suppressor; Rassf1B; Rassf1C; RDA32; REH3P21; tumor suppressor protein RDA32; wu:fc17f02; WUGSC:H_LUCA12.5; zgc:112224; zgc:92505; zgc:92505 protein
Common Name RASSF1
Gene Symbol RASSF1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence KFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVDEPVEWETPDLSQAEIEQKIKEYNAQINSNLFMSLNKDG
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less