missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP96381

Invitrogen™ Human RASA2 (aa 793-850) Control Fragment Recombinant Protein

Catalog No. RP96381
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP96381 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP96381 Supplier Invitrogen™ Supplier No. RP96381

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57247 (PA5-57247. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Ras-related low molecular mass GTPases participate in signal transduction involving a variety of cellular functions, including cell-cycle progression, cellular differentiation, cytoskeletal organization, protein transport and secretion. The Ras-GTPase-activating protein (RASGAP) forms a complex with a second protein, p190, in growth factor stimulated and tyrosinekinase transformed cells. The RASGAP p190 complex may serve to couple Ras- and Rho-mediated signaling pathways. RASGAP forms an abundant SH2-mediated complex with p190 RhoGAP in cells expressing activated tyrosine kinases.

Specifications

Accession Number Q15283
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5922
Name Human RASA2 (aa 793-850) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 5430433H21Rik; AA517451; AU023900; CMAVM; CM-AVM; DKFZp434N071; GAP; GAP1M; GTPase-activating protein 1 m; GTPase-activating protein of RAS; p120GAP; p120RASGAP; PKWS; ras GTPase-activating protein 2; RAS p21 protein activator 2; RASA; Rasa2; RASGAP
Common Name RASA2
Gene Symbol RASA2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PDDYSNFVIEDSVTTFKTIQQIKSIIEKLDEPHEKYRKKRSSSAKYGSKENPIVGKAS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less