missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human RAMP2 (aa 44-136) Control Fragment Recombinant Protein

Catalog No. RP106369
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106369 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106369 Supplier Invitrogen™ Supplier No. RP106369

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (55%), Rat (55%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65695 (PA5-65695. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the RAMP family of single-transmembrane-domain proteins, called receptor (calcitonin) activity modifying proteins (RAMPs). RAMPs are type I transmembrane proteins with an extracellular N terminus and a cytoplasmic C terminus. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a receptor with seven transmembrane domains, can function as either a calcitonin-gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. In the presence of this (RAMP2) protein, CRLR functions as an adrenomedullin receptor. The RAMP2 protein is involved in core glycosylation and transportation of adrenomedullin receptor to the cell surface.

Specifications

Accession Number O60895
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 10266
Name Human RAMP2 (aa 44-136) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias calcitonin receptor-like receptor activity modifying protein 2; calcitonin-receptor-like receptor activity-modifying protein 2; CRLR activity-modifying protein 2; OTTMUSP00000002615; OTTMUSP00000037624; Ramp2; receptor (calcitonin) activity modifying protein 2; receptor (G protein-coupled) activity modifying protein 2; receptor activity modifying protein 2; receptor activity modifying protein 2 isoform; receptor activity-modifying protein 2; receptor-activity-modifying protein 2; RP23-281C18.6
Common Name RAMP2
Gene Symbol Ramp2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence PLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQP
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less