missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP106917

Invitrogen™ Human RALYL (aa 141-194) Control Fragment Recombinant Protein

Catalog No. RP106917
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP106917 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP106917 Supplier Invitrogen™ Supplier No. RP106917

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (91%), Rat (91%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66235 (PA5-66235. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

RALYL belongs to the RRM HNRPC family, RALY subfamily. It contains 1 RRM (RNA recognition motif) domain. The functions of RALYL remain unknown.

Specifications

Accession Number Q86SE5
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 138046
Name Human RALYL (aa 141-194) Control Fragment
Quantity 100 μL
Gene Alias 0710005M24Rik; Heterogeneous nuclear ribonucleoprotein C-like 3; hnRNP core protein C-like 3; HNRPCL3; hRALYL; RALY RNA binding protein like; RALY RNA binding protein-like; RALYL; RNA-binding Raly-like protein; Unknown (protein for MGC:133552)
Common Name RALYL
Gene Symbol RALYL
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence DYHGRVPPPPRAVIPLKRPRVAVTTTRRGKGVFSMKGGSRSTASGSTGSKLKSD
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less