missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP99468

Invitrogen™ Human RALGAPA2 (aa 1484-1587) Control Fragment Recombinant Protein

Catalog No. RP99468
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
RP99468 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. RP99468 Supplier Invitrogen™ Supplier No. RP99468

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60088 (PA5-60088. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Catalytic subunit of the heterodimeric RalGAP2 complex which acts as a GTPase activator for the Ras-like small GTPases RALA and RALB.

Specifications

Accession Number Q2PPJ7
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 57186
Name Human RALGAPA2 (aa 1484-1587) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 250 kDa substrate of Akt; A230067G21Rik; akt substrate AS250; AS250; bA287B20.1; BC053994; C20orf74; dJ1049G11; dJ1049G11.4; Kiaa1272; p220; pp250; Ral GTPase activating protein catalytic alpha subunit 2; Ral GTPase activating protein, alpha subunit 2 (catalytic); ral GTPase-activating protein alpha subunit 2; ral GTPase-activating protein subunit alpha-2; RALGAPA2; RapGAPalpha2; RGC2
Common Name RALGAPA2
Gene Symbol RALGAPA2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence CLAPNGRNPSFLISSWHRDTFGPQKDSSQVEEGDDVLDKLLENIGHTSPECLLPSQLNLNEPSLTPCGMNYDQEKEIIEVILRQNAQEDEYIQSHNFDSAMKVT
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less