missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human RADIL (aa 3-83) Control Fragment Recombinant Protein
Recombinant Protein
Supplier: Invitrogen™ RP101382
Description
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62479 (PA5-62479. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Radil is a broadly expressed adapter protein that contains a RA-like domain, a PDZ domain and a DIL domain. Like RAPL and RIAM, Radil interacts preferentially with active GTP-bound Rap1, and overexpression of Radil enhances integrin-mediated adhesion. In addition, Radil knock down inhibits cell-substrate adhesion in HT1080, AD293, and NMuMG cells and results in migration defects in SW1353 and zebrafish neural crest cells. Radil regulates neutrophil adhesion by specifically enhancing beta2-integrin activation, as well as focal adhesion kinase (FAK) and paxillin phosphorylation.Specifications
| Q96JH8 | |
| Blocking Assay, Control | |
| 55698 | |
| 100 μL | |
| AI536456; D930005D10Rik; KIAA1849; Radil; Rap associating with DIL domain; Rap GTPase interactor; Ras association and DIL domains; ras-associating and dilute domain-containing protein; RASIP2 | |
| RADIL | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human RADIL (aa 3-83) Control Fragment | |
| RUO | |
| RADIL | |
| Unconjugated | |
| Recombinant | |
| YGTHFIMSPPTKSKLKRQSQLLSSMLSRTLSYKYRDLDSTFSSLGASDDPAELSTQLSAPGVLKVFGDSVCTGTHYKSVLA | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |